Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
DEMGLGKT3.6.1;In phosphorous-containing anhydrides. 506
  • Domain: Helicase ATP-binding
MGLGKTIQ3.6.1;In phosphorous-containing anhydrides. 508
  • Domain: Helicase ATP-binding
DEAHRLK3.6.1;In phosphorous-containing anhydrides. 614
  • Domain: Helicase ATP-binding
TGTPLQN3.6.1;In phosphorous-containing anhydrides. 642
  • Domain: Helicase ATP-binding
LLHFIMP3.6.1;In phosphorous-containing anhydrides. 656
  • Domain: Helicase ATP-binding
RVLIFSQM3.6.1;In phosphorous-containing anhydrides. 806
  • Domain: Helicase C-terminal
VLIFSQMVR3.6.1;In phosphorous-containing anhydrides. 807
  • Domain: Helicase C-terminal
FLLSTRA3.6.1;In phosphorous-containing anhydrides. 860
  • Domain: Helicase C-terminal
LSTRAGGLG3.6.1;In phosphorous-containing anhydrides. 862
  • Domain: Helicase C-terminal
AGGLGINL3.6.1;In phosphorous-containing anhydrides. 866
  • Domain: Helicase C-terminal
IFDSDWNP3.6.1;In phosphorous-containing anhydrides. 881
  • Domain: Helicase C-terminal
DSDWNPQ3.6.1;In phosphorous-containing anhydrides. 883
  • Domain: Helicase C-terminal
RAHRIGQ3.6.1;In phosphorous-containing anhydrides. 897
  • Domain: Helicase C-terminal
ERMRPVK3.6.1;In phosphorous-containing anhydrides. 1419 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MNGHSDEESVRNSSGESSQSDDDSGSASGSGSGSSSGSSSDGSSSQSGSSDSDSGSESGSQSESESDTSRENKVQAKPPKVDGAEFWKSSPSILAVQRSA
ILKKQQQQQQQQQHQASSNSGSEEDSSSSEDSDDSSSEVKRKKHKDEDWQMSGSGSPSQSGSDSESEEEREKSSCDETESDYEPKNKVKSRKPQNRSKSK
NGKKILGQKKRQIDSSEEDDDEEDYDNDKRSSRRQATVNVSYKEDEEMKTDSDDLLEVCGEDVPQPEEEEFETIERFMDCRIGRKGATGATTTIYAVEAD
GDPNAGFEKNKEPGEIQYLIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKKKDQETKRWLKNASPEDVEYYNCQQELTDDLHKQYQIVERIIAHSNQ
KSAAGYPDYYCKWQGLPYSECSWEDGALISKKFQACIDEYFSRNQSKTTPFKDCKVLKQRPRFVALKKQPSYIGGHEGLELRDYQLNGLNWLAHSWCKGN
SCILA
DEMGLGKTIQTISFLNYLFHEHQLYGPFLLVVPLSTLTSWQREIQTWASQMNAVVYLGDINSRNMIRTHEWTHHQTKRLKFNILLTTYEILLKDK
AFLGGLNWAFIGV
DEAHRLKNDDSLLYKTLIDFKSNHRLLITGTPLQNSLKELWSLLHFIMPEKFSSWEDFEEEHGKGREYGYASLHKELEPFLLRRVKK
DVEKSLPAKVEQILRMEMSALQKQYYKWILTRNYKALSKGSKGSTSGFLNIMMELKKCCNHCYLIKPPDNNEFYNKQEALQHLIRSSGKLILLDKLLIRL
RERGN
RVLIFSQMVRMLDILAEYLKYRQFPFQRLDGSIKGELRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHR
IGQ
KKQVNIYRLVTKGSVEEDILERAKKKMVLDHLVIQRMDTTGKTVLHTGSAPSSSTPFNKEELSAILKFGAEELFKEPEGEEQEPQEMDIDEILKRAE
THENEPGPLTVGDELLSQFKVANFSNMDEDDIELEPERNSKNWEEIIPEDQRRRLEEEERQKELEEIYMLPRMRNCAKQISFNGSEGRRSRSRRYSGSDS
DSISEGKRPKKRGRPRTIPRENIKGFSDAEIRRFIKSYKKFGGPLERLDAIARDAELVDKSETDLRRLGELVHNGCIKALKDSSSGTERTGGRLGKVKGP
TFRISGVQVNAKLVISHEEELIPLHKSIPSDPEERKQYTIPCHTKAAHFDIDWGKEDDSNLLIGIYEYGYGSWEMIKMDPDLSLTHKILPDDPDKKPQAK
QLQTRADYLIKLLSRDLAKKEALSGAGSSKRRKARAKKNKAMKSIKVKEEIKSDSSPLPSEKSDEDDDKLSESKSDGRERSKKSSVSDAPVHITASGEPV
PISEESEELDQKTFSICK
ERMRPVKAALKQLDRPEKGLSEREQLEHTRQCLIKIGDHITECLKEYTNPEQIKQWRKNLWIFVSKFTEFDARKLHKLYKHA
IKKRQESQQNSDQNSNLNPHVIRNPDVERLKENTNHDDSSRDSYSSDRHLTQYHDHHKDRHQGDSYKKSDSRKRPYSSFSNGKDHRDWDHYKQDSRYYSD
REKHRKLDDHRSRDHRSNLEGSLKDRSHSDHRSHSDHRLHSDHRSSSEYTHHKSSRDYRYHSDWQMDHRASSSGPRSPLDQRSPYGSRSPFEHSVEHKST
PEHTWSSRKT



DME EC Prediction for this protein is: 3.6.1
Check another protein