Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
YQRYYSLQ1.14.11;With 2-oxoglutarate as one donor 113 -
DYWKNAAFLYGLGLVYF1.14.11;With 2-oxoglutarate as one donor 122 -
FCRAKEIHLRLG1.14.11;With 2-oxoglutarate as one donor 160 -
EIQFHIAHLYETQRKYHSAK1.14.11;With 2-oxoglutarate as one donor 203 -
DPNSGQSWYFLGRCYS1.14.11;With 2-oxoglutarate as one donor 277 -
IGKVQDAF1.14.11;With 2-oxoglutarate as one donor 294 -
SEASADTWCSIGVLYQQQNQP1.14.11;With 2-oxoglutarate as one donor 311 -
GTCDKVNNIHP1.14.11;With 2-oxoglutarate as one donor 742 -
ASSPSSAIST1.14.11;With 2-oxoglutarate as one donor 763 -
KLNPPTPSIYLE1.14.11;With 2-oxoglutarate as one donor 882 -
VEVRTQLLQPADENWDP1.14.11;With 2-oxoglutarate as one donor 945 -
SHTTIAKYAQYQA1.14.11;With 2-oxoglutarate as one donor 975 -
SFQESLREENE1.14.11;With 2-oxoglutarate as one donor 989 -
IKFGTNIDLSD1.14.11;With 2-oxoglutarate as one donor 1029 -
QRPGDLVWINAGTVHWVQA1.14.11;With 2-oxoglutarate as one donor 1159
  • Domain: JmjC
GWCNNIAWNVGPLTA1.14.11;With 2-oxoglutarate as one donor 1179
  • Domain: JmjC

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MKSCAVSLTTAAVAFGDEAKKMAEGKASRESEEESVSLTVEEREALGGMDSRLFGFVRLHEDGARTKTLLGKAVRCYESLILKAEGKVESDFFCQLGHFN
LLLEDYSKALSA
YQRYYSLQADYWKNAAFLYGLGLVYFYYNAFHWAIKAFQDVLYVDPSFCRAKEIHLRLGLMFKVNTDYKSSLKHFQLALIDCNPCTLS
NA
EIQFHIAHLYETQRKYHSAKEAYEQLLQTENLPAQVKATVLQQLGWMHHNMDLVGDKATKESYAIQYLQKSLEADPNSGQSWYFLGRCYSSIGKVQDA
F
ISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGTLYESCNQPQDAIKCYLNAARSKRCSNTSTLAARIKFLQNGSDN
WNGGQSLSHHPVQQVYSLCLTPQKLQHLEQLRANRDNLNPAQKHQLEQLESQFVLMQQMRHKEVAQVRTTGIHNGAITDSSLPTNSVSNRQPHGALTRVS
SVSQPGVRPACVEKLLSSGAFSAGCIPCGTSKILGSTDTILLGSNCIAGSESNGNVPYLQQNTHTLPHNHTDLNSSTEEPWRKQLSNSAQGLHKSQSSCL
SGPNEEQPLFSTGSAQYHQATSTGIKKANEHLTLPSNSVPQGDADSHLSCHTATSGGQQGIMFTKESKPSKNRSLVPETSRHTGDTSNGCADVKGLSNHV
HQLIADAVSSPNHGDSPNLLIADNPQLSALLIGKANGNVGT
GTCDKVNNIHPAVHTKTDHSVASSPSSAISTATPSPKSTEQRSINSVTSLNSPHSGLHT
VNGEGLGKSQSSTKVDLPLASHRSTSQILPSMSVSICPSSTEVLKACRNPGKNGLSNSCILLDKCPPPRPPTSPYPPLPKD
KLNPPTPSIYLENKRDAFF
PPLHQFCTNPKNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHM
VEVRTQLLQPADENWDPTGTKKIWRCESNRSHTTIAKYAQYQASSFQESLREENEK
RTQHKDHSDNESTSSENSGRRRKGPFKT
IKFGTNIDLSDNKKWKLQLHELTKLPAFARVVSAGNLLTHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFC
SVNINIGPGDCEWFVVPEDYWGVLNDFCEKNNLNFLMSSWWPNLEDLYEANVPVYRFI
QRPGDLVWINAGTVHWVQAVGWCNNIAWNVGPLTACQYKLAV
ERYEWNKLKSVKSPVPMVHLSWNMARNIKVSDPKLFEMIKYCLLKILKQYQTLREALVAAGKEVIWHGRTNDEPAHYCSICEVEVFNLLFVTNESNTQKT
YIVHCHDCARKTSKSLENFVVLEQYKMEDLIQVYDQFTLALSLSSSS



DME EC Prediction for this protein is: 1.14.11
Check another protein