Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
YIPPHLR3.6.1;In phosphorous-containing anhydrides. 38 -
DKDSSGWS3.6.1;In phosphorous-containing anhydrides. 54 -
DKDAYSSFGSR3.6.1;In phosphorous-containing anhydrides. 65 -
GSGSRGRFD3.6.1;In phosphorous-containing anhydrides. 89 -
TGINFEKYDDIPV3.6.1;In phosphorous-containing anhydrides. 156 -
IPVEATG3.6.1;In phosphorous-containing anhydrides. 166 -
NCPPHIE3.6.1;In phosphorous-containing anhydrides. 174 -
MGEIIMGNI3.6.1;In phosphorous-containing anhydrides. 187 -
PTPVQKHAIPII3.6.1;In phosphorous-containing anhydrides. 203 -
AQTGSGKT3.6.1;In phosphorous-containing anhydrides. 224
  • Domain: Helicase ATP-binding
TGSGKTAAF3.6.1;In phosphorous-containing anhydrides. 226
  • Domain: Helicase ATP-binding
ENGRYGRRKQ3.6.1;In phosphorous-containing anhydrides. 256
  • Domain: Helicase ATP-binding
LAPTREL3.6.1;In phosphorous-containing anhydrides. 272
  • Domain: Helicase ATP-binding
APTRELA3.6.1;In phosphorous-containing anhydrides. 273
  • Domain: Helicase ATP-binding
TRELAVQ3.6.1;In phosphorous-containing anhydrides. 275
  • Domain: Helicase ATP-binding
PCVVYGGA3.6.1;In phosphorous-containing anhydrides. 297
  • Domain: Helicase ATP-binding
VYGGADI3.6.1;In phosphorous-containing anhydrides. 300
  • Domain: Helicase ATP-binding
VATPGRL3.6.1;In phosphorous-containing anhydrides. 321
  • Domain: Helicase ATP-binding
ATPGRLVD3.6.1;In phosphorous-containing anhydrides. 322
  • Domain: Helicase ATP-binding
LVLDEADR3.6.1;In phosphorous-containing anhydrides. 344
  • Domain: Helicase ATP-binding
VLDEADRM3.6.1;In phosphorous-containing anhydrides. 345
  • Domain: Helicase ATP-binding
DEADRML3.6.1;In phosphorous-containing anhydrides. 347
  • Domain: Helicase ATP-binding
DMGFEPQ3.6.1;In phosphorous-containing anhydrides. 354
  • Domain: Helicase ATP-binding
FSATFPKEIQ3.6.1;In phosphorous-containing anhydrides. 381
  • Domain: Helicase ATP-binding
YIFLAVGRVGS3.6.1;In phosphorous-containing anhydrides. 400
  • Domain: Helicase ATP-binding
VGRVGSTSENI3.6.1;In phosphorous-containing anhydrides. 405 -
VGSTSENITQ3.6.1;In phosphorous-containing anhydrides. 408 -
DKRSFLLDLLNATGKDSL3.6.1;In phosphorous-containing anhydrides. 426
  • Domain: Helicase C-terminal
LVFVETK3.6.1;In phosphorous-containing anhydrides. 445
  • Domain: Helicase C-terminal
ADSLEDF3.6.1;In phosphorous-containing anhydrides. 454
  • Domain: Helicase C-terminal
TSIHGDR3.6.1;In phosphorous-containing anhydrides. 469
  • Domain: Helicase C-terminal
IHGDRSQ3.6.1;In phosphorous-containing anhydrides. 471
  • Domain: Helicase C-terminal
DREEALHQFRSG3.6.1;In phosphorous-containing anhydrides. 479
  • Domain: Helicase C-terminal
VAARGLDI3.6.1;In phosphorous-containing anhydrides. 500
  • Domain: Helicase C-terminal
VINFDLP3.6.1;In phosphorous-containing anhydrides. 513
  • Domain: Helicase C-terminal
HRIGRTGR3.6.1;In phosphorous-containing anhydrides. 527
  • Domain: Helicase C-terminal
NITKDLLDLLVEAKQEVPSWLE3.6.1;In phosphorous-containing anhydrides. 551
  • Domain: Helicase C-terminal
DYRQSSG3.6.1;In phosphorous-containing anhydrides. 601 -
RGFGGGGYGGFYN3.6.1;In phosphorous-containing anhydrides. 632 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSHVAVENALGLDQQFAGLDLNSSDNQSGGSTASKGRYIPPHLRNREATKGFYDKDSSGWSSSKDKDAYSSFGSRSDSRGKSSFFSDRGSGSRGRFDDRG
RSDYDGIGSRGDRSGFGKFERGGNSRWCDKSDEDDWSKPLPPSERLEQELFSGGN
TGINFEKYDDIPVEATGNNCPPHIESFSDVEMGEIIMGNIELTRY
TR
PTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVV
YGGADI
GQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEY
IFLAVGRVGSTSENITQ
KVVWVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAV
AARGLDI
SNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAYEHHYKGSSRGRSKSSRFSGGFGAR
DYRQSSGASSSSFSSSRASSSRSGGGGHGSSRGFGGGGYGGFYNSDGYGGNYNSQGVDWWGN



DME EC Prediction for this protein is: 3.6.1
Check another protein