Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
ELTGKRYPLSG2.5.1.26;Alkylglycerone-phosphate synthase. 112
  • Gene: ADAS
IIPIGGGTSV2.5.1.26;Alkylglycerone-phosphate synthase. 232
  • Domain: FAD-binding PCMH-typ
  • Gene: ADAS
TRASGMKKN2.5.1.26;Alkylglycerone-phosphate synthase. 316
  • Domain: FAD-binding PCMH-typ
  • Gene: ADAS
YGNIEDLVV2.5.1.26;Alkylglycerone-phosphate synthase. 326
  • Domain: FAD-binding PCMH-typ
  • Gene: ADAS
AFPNFEQGV2.5.1.26;Alkylglycerone-phosphate synthase. 394
  • Gene: ADAS
CRVTQTYDAGACIYFYF2.5.1.26;Alkylglycerone-phosphate synthase. 565
  • Active Site Y=Tyrosine at location 578 on the protein
  • Active Site Description: By similarity.
  • Gene: ADAS
GGSLSHHHGVG2.5.1.26;Alkylglycerone-phosphate synthase. 610
  • Gene: ADAS

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAEAAAAAGGTGLGAGASYGSAADRDRDPDPDRAGRRLRVLSGHLLGRPREALSTNECKARRAASAATAAPTATPAAQESGTIPKKRQEVMKWNGWGYND
SKFIFNKKGQI
ELTGKRYPLSGMGLPTFKEWIQNTLGVNVEHKTTSKASLNPSDTPPSVVNEDFLHDLKETNISYSQEADDRVFRAHGHCLHEIFLLREG
MFERIPDIVLWPTCHDDVVKIVNLACKYNLC
IIPIGGGTSVSYGLMCPADETRTIISLDTSQMNRILWVDENNLTAHVEAGITGQELERQLKESGYCTGH
EPDSLEFSTVGGWVS
TRASGMKKNIYGNIEDLVVHIKMVTPRGIIEKSCQGPRMSTGPDIHHFIMGSEGTLGVITEATIKIRPVPEYQKYGSVAFPNFEQ
GV
ACLREIAKQRCAPASIRLMDNKQFQFGHALKPQVSSIFTSFLDGLKKFYITKFKGFDPNQLSVATLLFEGDREKVLQHEKQVYDIAAKFGGLAAGEDN
GQRGYLLTYVIAYIRDLALEYYVLGESFETSAPWDRVVDLCRNVKERITRECKEKGVQFAPFST
CRVTQTYDAGACIYFYFAFNYRGISDPLTVFEQTEA
AAREEILAN
GGSLSHHHGVGKLRKQWLKESISDVGFGMLKSVKEYVDPNNIFGNRNLL



DME EC Prediction for this protein is: 2.5.1.26
Check another protein